PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.ERG91
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 744aa    MW: 82089.1 Da    PI: 6.8125
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.ERG91genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.9e-2186141156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++  +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Aradu.ERG91  86 KKGYHRHTQHQIQEMEAFFKQCPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 141
                  5778899**********************************************998 PP

2START184.84.7e-582814931206
                  HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
        START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                  ela +a++el ++a++++p+Wv+s     e++n+de+l++f +  +      ++e +r+s+v +m++++lve+l+d++ qW++++     +a tlev+
  Aradu.ERG91 281 ELAVAAMEELTRLAQVGDPLWVQSNqhctEILNEDEYLRTF-RVIGpkalgLRSESSRESAVIIMNHTKLVEILMDVN-QWSTMFCgivsRALTLEVL 376
                  57899************************************.4444799*****************************.******999********** PP

                  CTTEEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHH CS
        START  86 ssggalqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllr 182
                  s+g a  +  a  ++ splvp R+ +fvRy++++++g+w++vdvS+++e+      s+    ++pSg+lie+++ng+skvtw+ehv++++r +h+l++
  Aradu.ERG91 377 STGVAGNYNGALQVVASPLVPsRENYFVRYCKEHPDGRWTVVDVSLENESRSRR--SSR---RRPSGCLIEELPNGYSKVTWIEHVEVDDRGVHSLYK 469
                  ************************************************999763..333...59********************************** PP

                  HHHHHHHHHHHHHHHHHTXXXXXX CS
        START 183 slvksglaegaktwvatlqrqcek 206
                  +lvk gla+gak+w+atl+rqce+
  Aradu.ERG91 470 PLVKCGLAFGAKRWMATLERQCER 493
                  **********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.96E-1970143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-2270141IPR009057Homeodomain-like
PROSITE profilePS5007116.5283143IPR001356Homeobox domain
SMARTSM003894.3E-1985147IPR001356Homeobox domain
CDDcd000861.75E-1886144No hitNo description
PfamPF000462.6E-1886141IPR001356Homeobox domain
PROSITE patternPS000270118141IPR017970Homeobox, conserved site
PROSITE profilePS5084840.776272496IPR002913START domain
SuperFamilySSF559612.06E-30273495No hitNo description
CDDcd088755.26E-102276492No hitNo description
SMARTSM002341.5E-55281493IPR002913START domain
PfamPF018522.0E-48282493IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4392488IPR023393START-like domain
SuperFamilySSF559613.16E-20511729No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
RLERRKPVAV RSFLKFKGFA ESMFPTNVFD SHQQHMMLDM SSSHNESDLG IRTGDDEFFD  60
IKSATEIVME APSGDDEQDP NQRPKKKGYH RHTQHQIQEM EAFFKQCPHP DDKQRKELSR  120
ELGLEPLQVK FWFQNKRTQM KAQHERHENA ILKAENEKLR AENSRYKEAL SNATCPNCGG  180
PAALGEMSFD EQHLRIENAR LKQEIDRISG IAEKYVGKPV TSSHNSNHMA PHSRSLDLGV  240
GSYGGGSQSS AGGMVGEMYG GSELLRPFPV PCDSDKPRIV ELAVAAMEEL TRLAQVGDPL  300
WVQSNQHCTE ILNEDEYLRT FRVIGPKALG LRSESSRESA VIIMNHTKLV EILMDVNQWS  360
TMFCGIVSRA LTLEVLSTGV AGNYNGALQV VASPLVPSRE NYFVRYCKEH PDGRWTVVDV  420
SLENESRSRR SSRRRPSGCL IEELPNGYSK VTWIEHVEVD DRGVHSLYKP LVKCGLAFGA  480
KRWMATLERQ CERVASYIGG GAGELCGTSA EGRRSMLKLA ERMVMSFCTG VGASTAHAWT  540
TLSSDMDDVR VMTRKSMDDP GRPPGIVLCA ATSFSLPVPP NTLFHFLRDQ NSRSQWDILS  600
NRGLVQEITH IASSANVLSL LRVNSVNSSQ SNMLILQESC TDCSGSYVVY APVDMAAMNI  660
ILSGGDPDYL ALLPSGFAIL PDGLAASSGG SLLTVAFQIL VDSAPTAKLS LGSVATVNTL  720
IKCTVERIKA AVISDTTSFH NLAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015964876.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLI1JAV70.0I1JAV7_SOYBN; Uncharacterized protein
STRINGGLYMA01G45070.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein